PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA18G00209
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 245aa    MW: 28630.4 Da    PI: 7.7838
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA18G00209genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-172370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +l++++ + G g+W++ a   g++Rt+k+c++rw++yl
       AA18G00209 23 RGPWTPEEDIKLINYISLNGEGRWNSLAPSAGLNRTGKSCRLRWLNYL 70
                     89********************************************97 PP

2Myb_DNA-binding46.77.3e-1577119246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g  + +E++++++++ ++G++ W++Ia++++ gRt++++k++w++
       AA18G00209  77 GHISLQEQLIILQLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 119
                      666889***************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.7861874IPR017930Myb domain
SMARTSM007179.1E-152272IPR001005SANT/Myb domain
SuperFamilySSF466891.24E-2922117IPR009057Homeodomain-like
PfamPF002491.1E-162370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-222477IPR009057Homeodomain-like
CDDcd001672.67E-102570No hitNo description
SMARTSM007171.4E-1375123IPR001005SANT/Myb domain
PROSITE profilePS5129417.61275125IPR017930Myb domain
PfamPF002491.0E-1377119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2178123IPR009057Homeodomain-like
CDDcd001671.93E-980119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MMNIKKKEEE EEEEKKKMEV IRRGPWTPEE DIKLINYISL NGEGRWNSLA PSAGLNRTGK  60
SCRLRWLNYL RPDIRRGHIS LQEQLIILQL HSRWGNRWSK IAQHLPGRTD NEIKNYWRTR  120
VHKHAKLLKC DVNSKQFKDT MKHLWMPRLV EKIASQNVET FMDASSVTTT MSTSTSSESM  180
ETEASHGYSD LNGYYNGGNT IQMGNVANQV EHEILINHVT NGVDAFENLW SVDEFNDWLL  240
QQHFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-242111725120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006393501.11e-98hypothetical protein EUTSA_v10012051mg
SwissprotQ9LDE12e-75MY108_ARATH; Transcription factor MYB108
TrEMBLV4KLH41e-98V4KLH4_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.1__3889__AT1G48000.12e-93(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.15e-84myb domain protein 112